Dominios registrados 2018-01-06 - desde el primer registro

Dominios registrados el 2018-01-06 desde 11 página


De nombres de dominio
tplonder.bid
theofferservicesafe-system.bid
thebestprepared-forcontentsafe.bid
thebestpreparedforcontentfree.bid
theofferservicesafesystems.bid
transportstocking.bid
theofferservicesafe2systemsafe.bid
theofferservicesafesystemall.bid
thebestprepared-forcontentfree.bid
techaccomplish.bid
theofferservicesafesystemsafe.bid
theofferservicesafe4system.bid
treatmentmuscle.bid
theofferservicesafe-systemall.bid
theofferservicesafesystemsafeall.bid
trial18.bid
theofferservicesafe-4system.bid
thebestpreparedforcontentingall.bid
theofferservicesafesystemsload.bid
theofferservicesafesystemsafeclear.bid
thebestpreparedforcontentingalways.bid
theofferservicesafe4systems.bid
thebestpreparedforcontentsall.bid
tendencybushes.bid
theofferservicesafesystemclear.bid
tylerperez2230.bid
thoomoke.bid
theofferservicesafesystemsafeload.bid
theofferservicesafe-systemclear.bid
terocrit.bid
theofferservicesafesystemsperfect.bid
thebestpreparedforcontentingclear.bid
thebestpreparedforcontentsalways.bid
texturequarter.bid
theofferservicesafe4systemsafe.bid
theofferservicesafetosystem.bid
theofferservicesafesystemload.bid
thebestpreparedforcontentsclear.bid
thundertank.bid
theofferservicesafesystemsafenew.bid
thebestpreparedforcontentingfree.bid
thebestpreparedforcontentall.bid
theofferservicesafe-tosystem.bid
theofferservicesafeforsystem.bid
theofferservicesafe-systemload.bid
theofferservicesafesystemnew.bid
thebestprepared-forcontentall.bid
theofferservicesafetosystems.bid
ticonderogaonline.bid
thebestpreparedforcontentsfree.bid
theofferservicesafe-forsystem.bid
thebestpreparedforcontentingnew.bid
theofferservicesafetosystemsafe.bid
thebestpreparedforcontentingsafe.bid
tiendamazing.bid
thebestpreparedforcontentsnew.bid
thebestpreparedforcontentalways.bid
tablenight.bid
thebestpreparedforcontentnew.bid
thebestprepared-forcontentalways.bid
theofferservicesafeforsystems.bid
theofferservicesafe-systemnew.bid
tierney.bid
theofferservicesafesystemsafeperfect.bid
taxaaristotle.bid
thepinks.bid
tdnd.bid
tightness.bid
thebestprepared-forcontentnew.bid
theofferservicesafesystemsall.bid
thebestpreparedforcontentssafe.bid
theofferservicesafeforsystemsafe.bid
toothstep.bid
tlwy.bid
thepiratebays.bid
theofferservicesafe2system.bid
thepiratesbay.bid
theofferservicesafe-2system.bid
thebestpreparedforcontentclear.bid
thebestprepared-forcontentclear.bid
aurorahulsey5118.bid
amountjail.bid
authoritydonkey.bid
analysing496-info.bid
actionsupport.bid
autoinsuranceportland3.bid
andrewwilliams8436.bid
angelopouloscgiu.bid
auto-lucky.bid
activitymetal.bid
angierigatti8568.bid
awja.bid
anizanjs.bid
adaeth.bid
aprent.bid
additionoil.bid
afforsa.bid
agora2-tourism.bid
archtransport.bid
artdiscussion.bid
Bienvenido 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Final Página siguiente
Registry Database : the most valuable domain name registration information over Internet